PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC13730_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WOX
Protein Properties Length: 193aa    MW: 22092.8 Da    PI: 9.7471
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC13730_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.37e-202687157
                 TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 ++ R+++t eq++ L +lF+   r+ps++++++++++l    +++ ++V++WFqN++a+e++
  RrC13730_p1 26 KCGRWNPTVEQVKLLTDLFKAgLRTPSTDQIQKISMELsfygKIESKNVFYWFQNHKARERQ 87
                 568*****************99**************************************97 PP

2Wus_type_Homeobox112.22.8e-362689265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       ++ RW+Pt eQ+k+L++l+k+GlrtP++++iq+i++eL+ yGkie+kNVfyWFQN+kaRerqk+
        RrC13730_p1 26 KCGRWNPTVEQVKLLTDLFKAGLRTPSTDQIQKISMELSFYGKIESKNVFYWFQNHKARERQKR 89
                       678***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.5272388IPR001356Homeobox domain
SMARTSM003895.9E-42592IPR001356Homeobox domain
PfamPF000466.5E-172787IPR001356Homeobox domain
SuperFamilySSF466897.27E-112891IPR009057Homeodomain-like
CDDcd000865.63E-42989No hitNo description
Gene3DG3DSA:1.10.10.601.9E-72987IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MSSGEFSTRA RGLGNNNNGG GGTGTKCGRW NPTVEQVKLL TDLFKAGLRT PSTDQIQKIS  60
MELSFYGKIE SKNVFYWFQN HKARERQKRR KISTIDFDHR HQDTNLSIPQ RHNIRHHQQP  120
PKGTFEACEK DEKVIETLQL FPLSNVERAR ANITAASHNE YIREQVNTTV FSTYSSCGAE  180
MEHPPLDLRL SFL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892011e-166AC189201.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB005N03, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013610643.11e-123PREDICTED: WUSCHEL-related homeobox 7
SwissprotQ8H1D29e-80WOX5_ARATH; WUSCHEL-related homeobox 5
TrEMBLA0A078ECT31e-123A0A078ECT3_BRANA; BnaC09g49730D protein
TrEMBLA0A0D3EHJ71e-123A0A0D3EHJ7_BRAOL; Uncharacterized protein
STRINGBra009132.1-P1e-121(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40142857
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.13e-73WUSCHEL related homeobox 5